Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.4: UFC1-like [143072] (2 proteins) automatically mapped to Pfam PF08694 |
Protein automated matches [190848] (1 species) not a true protein |
Species Leishmania major [TaxId:5664] [189162] (1 PDB entry) |
Domain d3kpab_: 3kpa B: [179513] automated match to d1ywza1 |
PDB Entry: 3kpa (more details), 2.2 Å
SCOPe Domain Sequences for d3kpab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kpab_ d.20.1.4 (B:) automated matches {Leishmania major [TaxId: 5664]} svkesvsripllktkagprdgdkwtarlkeeyaslityvehnkasdshwfhlesnpqgtr wygtcwtyyknekyefemnfdipvtypqappeialpelegktvkmyrggkicmtthffpl warnvpyfgishvlalglgpwlsievpamveegylkp
Timeline for d3kpab_: