Lineage for d3kpab_ (3kpa B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2508127Family d.20.1.4: UFC1-like [143072] (2 protein domains)
    automatically mapped to Pfam PF08694
  6. 2508144Protein automated matches [190848] (1 species)
    not a true protein
  7. 2508145Species Leishmania major [TaxId:5664] [189162] (1 PDB entry)
  8. 2508147Domain d3kpab_: 3kpa B: [179513]
    automated match to d1ywza1

Details for d3kpab_

PDB Entry: 3kpa (more details), 2.2 Å

PDB Description: ubiquitin fold modifier conjugating enzyme from leishmania major (probable)
PDB Compounds: (B:) probable Ubiquitin fold modifier conjugating enzyme

SCOPe Domain Sequences for d3kpab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kpab_ d.20.1.4 (B:) automated matches {Leishmania major [TaxId: 5664]}
svkesvsripllktkagprdgdkwtarlkeeyaslityvehnkasdshwfhlesnpqgtr
wygtcwtyyknekyefemnfdipvtypqappeialpelegktvkmyrggkicmtthffpl
warnvpyfgishvlalglgpwlsievpamveegylkp

SCOPe Domain Coordinates for d3kpab_:

Click to download the PDB-style file with coordinates for d3kpab_.
(The format of our PDB-style files is described here.)

Timeline for d3kpab_: