Lineage for d3kpaa_ (3kpa A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898667Family d.20.1.4: UFC1-like [143072] (2 proteins)
    automatically mapped to Pfam PF08694
  6. 1898677Protein automated matches [190848] (1 species)
    not a true protein
  7. 1898678Species Leishmania major [TaxId:5664] [189162] (1 PDB entry)
  8. 1898679Domain d3kpaa_: 3kpa A: [179512]
    automated match to d1ywza1

Details for d3kpaa_

PDB Entry: 3kpa (more details), 2.2 Å

PDB Description: ubiquitin fold modifier conjugating enzyme from leishmania major (probable)
PDB Compounds: (A:) probable Ubiquitin fold modifier conjugating enzyme

SCOPe Domain Sequences for d3kpaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kpaa_ d.20.1.4 (A:) automated matches {Leishmania major [TaxId: 5664]}
svkesvsripllktkagprdgdkwtarlkeeyaslityvehnkasdshwfhlesnpqgtr
wygtcwtyyknekyefemnfdipvtypqappeialpelegktvkmyrggkicmtthffpl
warnvpyfgishvlalglgpwlsievpamveegylkp

SCOPe Domain Coordinates for d3kpaa_:

Click to download the PDB-style file with coordinates for d3kpaa_.
(The format of our PDB-style files is described here.)

Timeline for d3kpaa_: