Lineage for d3ko8a_ (3ko8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095731Species Pyrobaculum calidifontis [TaxId:410359] [189396] (5 PDB entries)
  8. 2095734Domain d3ko8a_: 3ko8 A: [179501]
    automated match to d2b69a1
    complexed with nad, po4

Details for d3ko8a_

PDB Entry: 3ko8 (more details), 1.8 Å

PDB Description: Crystal Structure of UDP-galactose 4-epimerase
PDB Compounds: (A:) NAD-dependent epimerase/dehydratase

SCOPe Domain Sequences for d3ko8a_:

Sequence, based on SEQRES records: (download)

>d3ko8a_ c.2.1.0 (A:) automated matches {Pyrobaculum calidifontis [TaxId: 410359]}
mrivvtggagfigshlvdklvelgyevvvvdnlssgrrefvnpsaelhvrdlkdyswgag
ikgdvvfhfaanpevrlsttepivhfnenvvatfnvlewarqtgvrtvvfassstvygda
dviptpeeepykpisvygaakaagevmcatyarlfgvrclavryanvvgprlrhgviydf
imklrrnpnvlevlgdgtqrksylyvrdaveatlaawkkfeemdapflalnvgnvdavrv
ldiaqivaevlglrpeirlvpstpdgrgwpgdvkymtlavtklmkltgwrptmtsaeavk
ktaedlakelw

Sequence, based on observed residues (ATOM records): (download)

>d3ko8a_ c.2.1.0 (A:) automated matches {Pyrobaculum calidifontis [TaxId: 410359]}
mrivvtggagfigshlvdklvelgyevvvvdnlssgrrefvnpsaelhvrdlkdyswgag
ikgdvvfhfaanpevrlsttepivhfnenvvatfnvlewarqtgvrtvvfassstvygda
dviptpeeepykpisvygaakaagevmcatyarlfgvrclavryanvvgprlrhgviydf
imklrrnpnvlevlqrksylyvrdaveatlaawkkfeemdapflalnvgnvdavrvldia
qivaevlglrpeirlvgdvkymtlavtklmkltgwrptmtsaeavkktaedlakelw

SCOPe Domain Coordinates for d3ko8a_:

Click to download the PDB-style file with coordinates for d3ko8a_.
(The format of our PDB-style files is described here.)

Timeline for d3ko8a_: