SCOPe 2.06: Domain d3ko6b_: 3ko6 B:

Lineage for d3ko6b_ (3ko6 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.1: GAF domain [55782] (8 proteins)

6. Protein Hypothetical protein ykl069wp [55783] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55784] (2 PDB entries)

8. Domain d3ko6b_: 3ko6 B: [179500]
   automated match to d1f5mb_
   complexed with sme

Details for d3ko6b_

PDB Entry: 3ko6, 2.55 Å

PDB Description: Crystal structure of yeast free methionine-R-sulfoxide reductase Ykg9 in complex with the substrate

PDB Compounds: (B:) UPF0067 GAF domain-containing protein YKL069W

SCOPe Domain Sequences for d3ko6b_:

Sequence; same for both SEQRES and ATOM records:

>d3ko6b_ d.110.2.1 (B:) Hypothetical protein ykl069wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stgfhhadhvnyssnlnkeeileqlllsyeglsdgqvnwvcnlsnassliwhaykslavd
inwagfyvtqaseentlilgpfqgkvacqmiqfgkgvcgtaastketqivpdvnkypghi
acdgetkseivvpiisndgktlgvididcldyegfdhvdkefleklaklinkscvf

Timeline for d3ko6b_:

• d3ko6b_ first appeared in SCOPe 2.01
  
• d3ko6b_ appears in SCOPe 2.05
  
• d3ko6b_ appears in SCOPe 2.07
  
• d3ko6b_ appears in the current release, SCOPe 2.08