Lineage for d1c7ya2 (1c7y A:65-150)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48649Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 48676Superfamily a.60.2: RuvA domain 2-like [47781] (2 families) (S)
  5. 48677Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein)
  6. 48678Protein DNA helicase RuvA subunit, middle domain [47783] (2 species)
  7. 48679Species Escherichia coli [TaxId:562] [47784] (5 PDB entries)
  8. 48684Domain d1c7ya2: 1c7y A:65-150 [17950]
    Other proteins in same PDB: d1c7ya1, d1c7ya3

Details for d1c7ya2

PDB Entry: 1c7y (more details), 3.1 Å

PDB Description: e.coli ruva-holliday junction complex

SCOP Domain Sequences for d1c7ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7ya2 a.60.2.1 (A:65-150) DNA helicase RuvA subunit, middle domain {Escherichia coli}
nkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkktaerl
ivemkdrfkglhgdlftpaadlvlts

SCOP Domain Coordinates for d1c7ya2:

Click to download the PDB-style file with coordinates for d1c7ya2.
(The format of our PDB-style files is described here.)

Timeline for d1c7ya2: