Lineage for d1c7ya2 (1c7y A:65-150)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715662Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 2715663Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein)
  6. 2715664Protein DNA helicase RuvA subunit, middle domain [47783] (3 species)
    tetramer; binds Holliday junction
  7. 2715665Species Escherichia coli [TaxId:562] [47784] (5 PDB entries)
  8. 2715670Domain d1c7ya2: 1c7y A:65-150 [17950]
    Other proteins in same PDB: d1c7ya1, d1c7ya3
    protein/DNA complex

Details for d1c7ya2

PDB Entry: 1c7y (more details), 3.1 Å

PDB Description: e.coli ruva-holliday junction complex
PDB Compounds: (A:) holliday junction DNA helicase ruva

SCOPe Domain Sequences for d1c7ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7ya2 a.60.2.1 (A:65-150) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]}
nkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkktaerl
ivemkdrfkglhgdlftpaadlvlts

SCOPe Domain Coordinates for d1c7ya2:

Click to download the PDB-style file with coordinates for d1c7ya2.
(The format of our PDB-style files is described here.)

Timeline for d1c7ya2: