| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) ![]() duplication: contains two helix-hairpin-helix (HhH) motifs |
| Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein) |
| Protein DNA helicase RuvA subunit, middle domain [47783] (3 species) tetramer; binds Holliday junction |
| Species Escherichia coli [TaxId:562] [47784] (5 PDB entries) |
| Domain d1c7ya2: 1c7y A:65-150 [17950] Other proteins in same PDB: d1c7ya1, d1c7ya3 protein/DNA complex |
PDB Entry: 1c7y (more details), 3.1 Å
SCOPe Domain Sequences for d1c7ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c7ya2 a.60.2.1 (A:65-150) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]}
nkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkktaerl
ivemkdrfkglhgdlftpaadlvlts
Timeline for d1c7ya2: