Lineage for d3ko6a_ (3ko6 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2210555Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2210556Family d.110.2.1: GAF domain [55782] (8 proteins)
  6. 2210597Protein Hypothetical protein ykl069wp [55783] (1 species)
  7. 2210598Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55784] (2 PDB entries)
  8. 2210601Domain d3ko6a_: 3ko6 A: [179499]
    automated match to d1f5mb_
    complexed with sme

Details for d3ko6a_

PDB Entry: 3ko6 (more details), 2.55 Å

PDB Description: Crystal structure of yeast free methionine-R-sulfoxide reductase Ykg9 in complex with the substrate
PDB Compounds: (A:) UPF0067 GAF domain-containing protein YKL069W

SCOPe Domain Sequences for d3ko6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ko6a_ d.110.2.1 (A:) Hypothetical protein ykl069wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stgfhhadhvnyssnlnkeeileqlllsyeglsdgqvnwvcnlsnassliwhaykslavd
inwagfyvtqaseentlilgpfqgkvacqmiqfgkgvcgtaastketqivpdvnkypghi
acdgetkseivvpiisndgktlgvididcldyegfdhvdkefleklaklinkscvf

SCOPe Domain Coordinates for d3ko6a_:

Click to download the PDB-style file with coordinates for d3ko6a_.
(The format of our PDB-style files is described here.)

Timeline for d3ko6a_: