SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3ko0t_ (3ko0 T:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1994353Family a.39.1.2: S100 proteins [47478] (2 protein domains)
    dimer: subunits are made of two EF-hands
  6. 1994354Protein Calcyclin (S100) [47479] (17 species)
  7. 1994447Species Human (Homo sapiens), s100a4 [TaxId:9606] [81754] (8 PDB entries)
    MTS1 protein
  8. 1994471Domain d3ko0t_: 3ko0 T: [179498]
    automated match to d1m31a_
    complexed with ca, tfp

Details for d3ko0t_

PDB Entry: 3ko0 (more details), 2.3 Å

PDB Description: Structure of the tfp-ca2+-bound activated form of the s100a4 Metastasis factor
PDB Compounds: (T:) Protein S100-A4

SCOPe Domain Sequences for d3ko0t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ko0t_ a.39.1.2 (T:) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}
acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
ldsnrdnevdfqeycvflsciammcneffegfp

SCOPe Domain Coordinates for d3ko0t_:

Click to download the PDB-style file with coordinates for d3ko0t_.
(The format of our PDB-style files is described here.)

Timeline for d3ko0t_: