Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
Protein Calcyclin (S100) [47479] (17 species) |
Species Human (Homo sapiens), s100a4 [TaxId:9606] [81754] (9 PDB entries) MTS1 protein |
Domain d3ko0m_: 3ko0 M: [179491] automated match to d1m31a_ complexed with ca, tfp |
PDB Entry: 3ko0 (more details), 2.3 Å
SCOPe Domain Sequences for d3ko0m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ko0m_ a.39.1.2 (M:) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn ldsnrdnevdfqeycvflsciammcneffegf
Timeline for d3ko0m_: