Lineage for d3ko0l_ (3ko0 L:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323269Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2323270Protein Calcyclin (S100) [47479] (17 species)
  7. 2323389Species Human (Homo sapiens), s100a4 [TaxId:9606] [81754] (9 PDB entries)
    MTS1 protein
  8. 2323413Domain d3ko0l_: 3ko0 L: [179490]
    automated match to d1m31a_
    complexed with ca, tfp

Details for d3ko0l_

PDB Entry: 3ko0 (more details), 2.3 Å

PDB Description: structure of the tfp-ca2+-bound activated form of the s100a4 metastasis factor
PDB Compounds: (L:) Protein S100-A4

SCOPe Domain Sequences for d3ko0l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ko0l_ a.39.1.2 (L:) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}
acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
ldsnrdnevdfqeycvflsciammcneffegfp

SCOPe Domain Coordinates for d3ko0l_:

Click to download the PDB-style file with coordinates for d3ko0l_.
(The format of our PDB-style files is described here.)

Timeline for d3ko0l_: