SCOPe 2.01: Domain d3knrc_: 3knr C:

Lineage for d3knrc_ (3knr C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein Zn metallo-beta-lactamase [56283] (11 species)

7. Species Bacillus cereus [TaxId:1396] [56284] (14 PDB entries)
   Uniprot P04190 31-257

8. Domain d3knrc_: 3knr C: [179473]
   automated match to d1bc2a_
   complexed with acy, gol, so4, zn; mutant

Details for d3knrc_

PDB Entry: 3knr, 1.71 Å

PDB Description: bacillus cereus metallo-beta-lactamase cys221asp mutant, 1 mm zn(ii)

PDB Compounds: (C:) Beta-lactamase 2

SCOPe Domain Sequences for d3knrc_:

Sequence; same for both SEQRES and ATOM records:

>d3knrc_ d.157.1.1 (C:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]}
tisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltkeliemvekk
fqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqtvtnlk
fgnmkvetfypgkghtednivvwlpqynilvggdlvkstsakdlgnvadayvnewstsie
nvlkryrninavvpghgevgdkglllhtldllk

Timeline for d3knrc_:

• d3knrc_ is new in SCOPe 2.01-stable
  
• d3knrc_ appears in SCOPe 2.02
  
• d3knrc_ appears in the current release, SCOPe 2.08