Lineage for d3knra_ (3knr A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231217Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2231218Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 2231231Species Bacillus cereus [TaxId:1396] [56284] (27 PDB entries)
    Uniprot P04190 31-257
  8. 2231240Domain d3knra_: 3knr A: [179471]
    automated match to d1bc2a_
    complexed with acy, gol, so4, zn; mutant

Details for d3knra_

PDB Entry: 3knr (more details), 1.71 Å

PDB Description: bacillus cereus metallo-beta-lactamase cys221asp mutant, 1 mm zn(ii)
PDB Compounds: (A:) Beta-lactamase 2

SCOPe Domain Sequences for d3knra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3knra_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]}
gtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltkeliemvek
kfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgdlqtvtnl
kfgnmkvetfypgkghtednivvwlpqynilvggdlvkstsakdlgnvadayvnewstsi
envlkryrninavvpghgevgdkglllhtldllk

SCOPe Domain Coordinates for d3knra_:

Click to download the PDB-style file with coordinates for d3knra_.
(The format of our PDB-style files is described here.)

Timeline for d3knra_: