Lineage for d3kmta_ (3kmt A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2083143Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2083796Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 2083837Family b.85.7.2: Viral histone H3 Lysine 27 Methyltransferase [82207] (1 protein)
    consists of SET domain only; dimeric
  6. 2083838Protein Viral histone H3 Lysine 27 Methyltransferase [82208] (1 species)
  7. 2083839Species Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId:10506] [82209] (5 PDB entries)
  8. 2083842Domain d3kmta_: 3kmt A: [179456]
    automated match to d1n3ja_
    complexed with sah

Details for d3kmta_

PDB Entry: 3kmt (more details), 1.78 Å

PDB Description: Crystal structure of vSET/SAH/H3 ternary complex
PDB Compounds: (A:) A612L protein

SCOPe Domain Sequences for d3kmta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kmta_ b.85.7.2 (A:) Viral histone H3 Lysine 27 Methyltransferase {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]}
mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn

SCOPe Domain Coordinates for d3kmta_:

Click to download the PDB-style file with coordinates for d3kmta_.
(The format of our PDB-style files is described here.)

Timeline for d3kmta_: