Lineage for d3kmpb_ (3kmp B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2557723Fold d.164: SMAD MH1 domain [56365] (1 superfamily)
    consists of four alpha-helices and three beta-ribbons
  4. 2557724Superfamily d.164.1: SMAD MH1 domain [56366] (2 families) (S)
  5. 2557725Family d.164.1.1: SMAD MH1 domain [56367] (2 proteins)
  6. 2557732Protein automated matches [191135] (1 species)
    not a true protein
  7. 2557733Species Mouse (Mus musculus) [TaxId:10090] [189242] (1 PDB entry)
  8. 2557735Domain d3kmpb_: 3kmp B: [179453]
    automated match to d1ozja_
    protein/DNA complex; complexed with gol, zn

Details for d3kmpb_

PDB Entry: 3kmp (more details), 2.7 Å

PDB Description: crystal structure of smad1-mh1/dna complex
PDB Compounds: (B:) smad1-mh1

SCOPe Domain Sequences for d3kmpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kmpb_ d.164.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tspavkrllgwkqgdeeekwaekavdalvkklkkkkgameelekalscpgqpsncvtipr
sldgrlqvshrkglphviycrvwrwpdlqshhelkpleccefpfgskqkevcinpyhykr
ves

SCOPe Domain Coordinates for d3kmpb_:

Click to download the PDB-style file with coordinates for d3kmpb_.
(The format of our PDB-style files is described here.)

Timeline for d3kmpb_: