SCOPe 2.06: Domain d3kmja_: 3kmj A:

Lineage for d3kmja_ (3kmj A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (4 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.2: Viral histone H3 Lysine 27 Methyltransferase [82207] (1 protein)
   consists of SET domain only; dimeric

6. Protein Viral histone H3 Lysine 27 Methyltransferase [82208] (1 species)

7. Species Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId:10506] [82209] (5 PDB entries)

8. Domain d3kmja_: 3kmj A: [179450]
   automated match to d1n3ja_
   complexed with so4

Details for d3kmja_

PDB Entry: 3kmj, 1.85 Å

PDB Description: Crystal structure of vSET under condition B

PDB Compounds: (A:) A612L protein

SCOPe Domain Sequences for d3kmja_:

Sequence; same for both SEQRES and ATOM records:

>d3kmja_ b.85.7.2 (A:) Viral histone H3 Lysine 27 Methyltransferase {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]}
mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn

Timeline for d3kmja_:

• d3kmja_ first appeared in SCOPe 2.01
  
• d3kmja_ appears in SCOPe 2.05
  
• d3kmja_ appears in SCOPe 2.07
  
• d3kmja_ appears in the current release, SCOPe 2.08