Lineage for d1coka_ (1cok A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4264Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 4265Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 4270Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (3 proteins)
  6. Protein C-terminal domain of p73 [47779] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [47780] (2 PDB entries)
  8. 4274Domain d1coka_: 1cok A: [17945]

Details for d1coka_

PDB Entry: 1cok (more details)

PDB Description: structure of the c-terminal domain of p73

SCOP Domain Sequences for d1coka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1coka_ a.60.1.2 (A:) C-terminal domain of p73 {Human (Homo sapiens)}
yhadpslvsfltglgcpncieyftsqglqsiyhlqnltiedlgalkipeqyrmtiwrglq
dlkqghdy

SCOP Domain Coordinates for d1coka_:

Click to download the PDB-style file with coordinates for d1coka_.
(The format of our PDB-style files is described here.)

Timeline for d1coka_: