Lineage for d1dxsa_ (1dxs A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 642791Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 642823Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (15 proteins)
  6. 642827Protein C-terminal domain of p73 [47779] (1 species)
  7. 642828Species Human (Homo sapiens) [TaxId:9606] [47780] (2 PDB entries)
  8. 642829Domain d1dxsa_: 1dxs A: [17944]

Details for d1dxsa_

PDB Entry: 1dxs (more details), 2.54 Å

PDB Description: crystal structure of the c-terminal sterile alpha motif (sam) domain of human p73 alpha splice variant
PDB Compounds: (A:) p53-like transcription factor

SCOP Domain Sequences for d1dxsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxsa_ a.60.1.2 (A:) C-terminal domain of p73 {Human (Homo sapiens) [TaxId: 9606]}
slvsfltglgcpncieyftsqglqsiyhlqnltiedlgalkipeqyrmtiwrglqdl

SCOP Domain Coordinates for d1dxsa_:

Click to download the PDB-style file with coordinates for d1dxsa_.
(The format of our PDB-style files is described here.)

Timeline for d1dxsa_: