Lineage for d1dxsa_ (1dxs A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4264Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 4265Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 4270Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (3 proteins)
  6. Protein C-terminal domain of p73 [47779] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [47780] (2 PDB entries)
  8. Domain d1dxsa_: 1dxs A: [17944]

Details for d1dxsa_

PDB Entry: 1dxs (more details), 2.54 Å

PDB Description: crystal structure of the c-terminal sterile alpha motif (sam) domain of human p73 alpha splice variant

SCOP Domain Sequences for d1dxsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxsa_ a.60.1.2 (A:) C-terminal domain of p73 {Human (Homo sapiens)}
slvsfltglgcpncieyftsqglqsiyhlqnltiedlgalkipeqyrmtiwrglqdl

SCOP Domain Coordinates for d1dxsa_ are not available.

Timeline for d1dxsa_: