SCOPe 2.08: Domain d3kmaa_: 3kma A:

Lineage for d3kmaa_ (3kma A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (4 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core
   Pfam PF00856

5. Family b.85.7.2: Viral histone H3 Lysine 27 Methyltransferase [82207] (1 protein)
   consists of SET domain only; dimeric

6. Protein Viral histone H3 Lysine 27 Methyltransferase [82208] (1 species)

7. Species Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId:10506] [82209] (5 PDB entries)

8. Domain d3kmaa_: 3kma A: [179434]
   automated match to d1n3ja_
   complexed with cl, gol, so4

Details for d3kmaa_

PDB Entry: 3kma, 1.6 Å

PDB Description: Crystal Structure of vSET under Condition A

PDB Compounds: (A:) A612L protein

SCOPe Domain Sequences for d3kmaa_:

Sequence; same for both SEQRES and ATOM records:

>d3kmaa_ b.85.7.2 (A:) Viral histone H3 Lysine 27 Methyltransferase {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]}
mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisy

Timeline for d3kmaa_:

• d3kmaa_ first appeared in SCOPe 2.01
  
• d3kmaa_ appears in SCOPe 2.07