Lineage for d1sgg__ (1sgg -)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282277Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 282278Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 282294Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (5 proteins)
  6. 282302Protein EphB2 receptor [47776] (2 species)
  7. 282303Species Chicken (Gallus gallus) [TaxId:9031] [47778] (1 PDB entry)
  8. 282304Domain d1sgg__: 1sgg - [17943]

Details for d1sgg__

PDB Entry: 1sgg (more details)

PDB Description: the solution structure of sam domain from the receptor tyrosine kinase ephb2, nmr, 10 structures

SCOP Domain Sequences for d1sgg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgg__ a.60.1.2 (-) EphB2 receptor {Chicken (Gallus gallus)}
ytsfntvdewldaikmsqykesfasagfttfdivsqmtvedilrvgvtlaghqkkilnsi
qvmraqm

SCOP Domain Coordinates for d1sgg__:

Click to download the PDB-style file with coordinates for d1sgg__.
(The format of our PDB-style files is described here.)

Timeline for d1sgg__: