Lineage for d1sgg__ (1sgg -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4264Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 4265Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 4270Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (3 proteins)
  6. 4278Protein EphB2 receptor [47776] (2 species)
  7. 4279Species Chicken (Gallus gallus) [TaxId:9031] [47778] (1 PDB entry)
  8. 4280Domain d1sgg__: 1sgg - [17943]

Details for d1sgg__

PDB Entry: 1sgg (more details)

PDB Description: the solution structure of sam domain from the receptor tyrosine kinase ephb2, nmr, 10 structures

SCOP Domain Sequences for d1sgg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgg__ a.60.1.2 (-) EphB2 receptor {Chicken (Gallus gallus)}
ytsfntvdewldaikmsqykesfasagfttfdivsqmtvedilrvgvtlaghqkkilnsi
qvmraqm

SCOP Domain Coordinates for d1sgg__:

Click to download the PDB-style file with coordinates for d1sgg__.
(The format of our PDB-style files is described here.)

Timeline for d1sgg__: