![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) ![]() |
![]() | Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (9 proteins) |
![]() | Protein EphB2 receptor [47776] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47777] (2 PDB entries) |
![]() | Domain d1f0ma_: 1f0m A: [17942] |
PDB Entry: 1f0m (more details), 2.2 Å
SCOP Domain Sequences for d1f0ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f0ma_ a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens)} ytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkkilnsi qvmraqmnqiq
Timeline for d1f0ma_: