| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) ![]() |
| Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
| Protein automated matches [190499] (26 species) not a true protein |
| Species Streptomyces avermitilis [TaxId:33903] [189136] (1 PDB entry) |
| Domain d3kl2c1: 3kl2 C:37-235 [179413] Other proteins in same PDB: d3kl2a2, d3kl2b2, d3kl2c2, d3kl2d2, d3kl2e2, d3kl2f2, d3kl2g2, d3kl2k2, d3kl2l2 automated match to d1j2ra_ complexed with so4 |
PDB Entry: 3kl2 (more details), 2.3 Å
SCOPe Domain Sequences for d3kl2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kl2c1 c.33.1.0 (C:37-235) automated matches {Streptomyces avermitilis [TaxId: 33903]}
eldpartaivlieyqneftsdggvlhgavadvmqhtgmlantvavvdaarqagvpimhap
itfaegygeltrhpygilkgvvdgkafvkgtwgaaivdelapvngdiviegkrgldtfas
tnldfilrskgvdtivlggfltnccvestmrtgyergfrvitltdcvaatsqeehnnais
ydfpmfsvpmtsadviaal
Timeline for d3kl2c1: