SCOP 1.75: Domain d1b4fh_: 1b4f H:

Lineage for d1b4fh_ (1b4f H:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (3 families)

5. Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (15 proteins)

6. Protein EphB2 receptor [47776] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47777] (2 PDB entries)

8. Domain d1b4fh_: 1b4f H: [17941]

Details for d1b4fh_

PDB Entry: 1b4f, 1.95 Å

PDB Description: oligomeric structure of the human ephb2 receptor sam domain

PDB Compounds: (H:) ephb2

SCOP Domain Sequences for d1b4fh_:

Sequence; same for both SEQRES and ATOM records:

>d1b4fh_ a.60.1.2 (H:) EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]}
rpdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkkil
nsiqvmraqmnqiqsv

Timeline for d1b4fh_:

• d1b4fh_ first appeared (with stable ids) in SCOP 1.55
  
• d1b4fh_ appears in SCOP 1.73
  
• d1b4fh_ appears in SCOPe 2.01
  
• d1b4fh_ appears in the current release, SCOPe 2.08