Lineage for d1b4fh_ (1b4f H:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4264Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 4265Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 4270Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (3 proteins)
  6. 4278Protein EphB2 receptor [47776] (2 species)
  7. 4281Species Human (Homo sapiens) [TaxId:9606] [47777] (2 PDB entries)
  8. 4289Domain d1b4fh_: 1b4f H: [17941]

Details for d1b4fh_

PDB Entry: 1b4f (more details), 1.95 Å

PDB Description: oligomeric structure of the human ephb2 receptor sam domain

SCOP Domain Sequences for d1b4fh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4fh_ a.60.1.2 (H:) EphB2 receptor {Human (Homo sapiens)}
rpdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkkil
nsiqvmraqmnqiqsv

SCOP Domain Coordinates for d1b4fh_:

Click to download the PDB-style file with coordinates for d1b4fh_.
(The format of our PDB-style files is described here.)

Timeline for d1b4fh_: