SCOPe 2.05: Domain d3kkua_: 3kku A:

Lineage for d3kkua_ (3kku A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Cruzain [54020] (1 species)

7. Species Trypanosoma cruzi [TaxId:5693] [54021] (24 PDB entries)

8. Domain d3kkua_: 3kku A: [179409]
   automated match to d1ewla_
   complexed with b95, edo, z22

Details for d3kkua_

PDB Entry: 3kku, 1.28 Å

PDB Description: Cruzain in complex with a non-covalent ligand

PDB Compounds: (A:) Cruzipain

SCOPe Domain Sequences for d3kkua_:

Sequence; same for both SEQRES and ATOM records:

>d3kkua_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
knswttqwgeegyiriakgsnqclvkeeassavvg

Timeline for d3kkua_:

• d3kkua_ first appeared in SCOPe 2.01
  
• d3kkua_ appears in SCOPe 2.04
  
• d3kkua_ appears in SCOPe 2.06
  
• d3kkua_ appears in the current release, SCOPe 2.08