Lineage for d3kkpa_ (3kkp A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163638Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1164515Protein automated matches [190047] (16 species)
    not a true protein
  7. 1164690Species Mouse (Mus musculus) [TaxId:10090] [186896] (9 PDB entries)
  8. 1164692Domain d3kkpa_: 3kkp A: [179407]
    automated match to d1x1ra1
    complexed with gnp, mg

Details for d3kkpa_

PDB Entry: 3kkp (more details), 1.35 Å

PDB Description: Crystal structure of M-Ras P40D in complex with GppNHp
PDB Compounds: (A:) Ras-related protein M-Ras

SCOPe Domain Sequences for d3kkpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kkpa_ c.37.1.8 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lptyklvvvgdggvgksaltiqffqkifvddydptiedsylkhteidnqwaildvldtag
qeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkdresfpmilvankvdl
mhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvirqq

SCOPe Domain Coordinates for d3kkpa_:

Click to download the PDB-style file with coordinates for d3kkpa_.
(The format of our PDB-style files is described here.)

Timeline for d3kkpa_: