| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein automated matches [190047] (37 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [186896] (13 PDB entries) |
| Domain d3kkoa_: 3kko A: [179404] automated match to d1x1ra1 complexed with gnp, mg, so4 |
PDB Entry: 3kko (more details), 1.9 Å
SCOPe Domain Sequences for d3kkoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kkoa_ c.37.1.8 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nlptyklvvvgdggvgksaltiqffqkifvdeydptiedsyrkhteidnqwaildvldta
gqeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkdresfpmilvankvd
lmhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvirqq
Timeline for d3kkoa_: