Lineage for d1b4fg_ (1b4f G:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 642791Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 642823Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (15 proteins)
  6. 642840Protein EphB2 receptor [47776] (2 species)
  7. 642843Species Human (Homo sapiens) [TaxId:9606] [47777] (2 PDB entries)
  8. 642850Domain d1b4fg_: 1b4f G: [17940]

Details for d1b4fg_

PDB Entry: 1b4f (more details), 1.95 Å

PDB Description: oligomeric structure of the human ephb2 receptor sam domain
PDB Compounds: (G:) ephb2

SCOP Domain Sequences for d1b4fg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4fg_ a.60.1.2 (G:) EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]}
pdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkkiln
siqvmraqmnqi

SCOP Domain Coordinates for d1b4fg_:

Click to download the PDB-style file with coordinates for d1b4fg_.
(The format of our PDB-style files is described here.)

Timeline for d1b4fg_: