Lineage for d3kkad_ (3kka D:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 916790Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 916791Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 916913Family a.60.1.0: automated matches [191306] (1 protein)
    not a true family
  6. 916914Protein automated matches [190031] (2 species)
    not a true protein
  7. 916919Species Human (Homo sapiens) [TaxId:9606] [188353] (3 PDB entries)
  8. 916922Domain d3kkad_: 3kka D: [179399]
    automated match to d1f0ma_
    complexed with cl

Details for d3kkad_

PDB Entry: 3kka (more details), 2.4 Å

PDB Description: co-crystal structure of the sam domains of epha1 and epha2
PDB Compounds: (D:) Ephrin type-A receptor 2

SCOPe Domain Sequences for d3kkad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kkad_ a.60.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvpfrtvsewlesikmqqytehfmaagytaiekvvqmtnddikrigvrlpghqkriaysl
lglkdqvn

SCOPe Domain Coordinates for d3kkad_:

Click to download the PDB-style file with coordinates for d3kkad_.
(The format of our PDB-style files is described here.)

Timeline for d3kkad_: