SCOPe 2.02: Domain d3kkac_: 3kka C:

Lineage for d3kkac_ (3kka C:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (3 PDB entries)

8. Domain d3kkac_: 3kka C: [179398]
   automated match to d1f0ma_
   complexed with cl

Details for d3kkac_

PDB Entry: 3kka, 2.4 Å

PDB Description: co-crystal structure of the sam domains of epha1 and epha2

PDB Compounds: (C:) Ephrin type-A receptor 2

SCOPe Domain Sequences for d3kkac_:

Sequence; same for both SEQRES and ATOM records:

>d3kkac_ a.60.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvsewlesikmqqytehfmaagytaiekvvqmtnddikrigvrlpghqkriaysllglk

Timeline for d3kkac_:

• d3kkac_ first appeared in SCOPe 2.01
  
• d3kkac_ appears in SCOPe 2.03
  
• d3kkac_ appears in the current release, SCOPe 2.08