![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
![]() | Family a.60.1.0: automated matches [191306] (1 protein) not a true family |
![]() | Protein automated matches [190031] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188353] (3 PDB entries) |
![]() | Domain d3kkac_: 3kka C: [179398] automated match to d1f0ma_ complexed with cl |
PDB Entry: 3kka (more details), 2.4 Å
SCOPe Domain Sequences for d3kkac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kkac_ a.60.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tvsewlesikmqqytehfmaagytaiekvvqmtnddikrigvrlpghqkriaysllglk
Timeline for d3kkac_: