Class a: All alpha proteins [46456] (171 folds) |
Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) |
Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (4 proteins) |
Protein EphB2 receptor [47776] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47777] (2 PDB entries) |
Domain d1b4fe_: 1b4f E: [17938] |
PDB Entry: 1b4f (more details), 1.95 Å
SCOP Domain Sequences for d1b4fe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b4fe_ a.60.1.2 (E:) EphB2 receptor {Human (Homo sapiens)} pdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkkiln siqvmraqmnqiqs
Timeline for d1b4fe_: