Lineage for d3khcb_ (3khc B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962884Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 963404Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 963621Family b.82.2.10: AlkB-like [141628] (3 proteins)
  6. 963637Protein automated matches [191077] (1 species)
    not a true protein
  7. 963638Species Escherichia coli K-12 [TaxId:83333] [189001] (14 PDB entries)
  8. 963653Domain d3khcb_: 3khc B: [179371]
    automated match to d2fd8a1
    protein/DNA complex; complexed with akg, co

Details for d3khcb_

PDB Entry: 3khc (more details), 2.2 Å

PDB Description: crystal structure of escherichia coli alkb in complex with ssdna containing a 1-methylguanine lesion
PDB Compounds: (B:) Alpha-ketoglutarate-dependent dioxygenase AlkB

SCOPe Domain Sequences for d3khcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3khcb_ b.82.2.10 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
epwqeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlg
wtthrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgakl
slhqdkaepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhg
iqplkagfhpltidcrynltfrqagkk

SCOPe Domain Coordinates for d3khcb_:

Click to download the PDB-style file with coordinates for d3khcb_.
(The format of our PDB-style files is described here.)

Timeline for d3khcb_: