Lineage for d1b4fd_ (1b4f D:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272162Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1272203Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 1272220Protein EphB2 receptor [47776] (2 species)
  7. 1272223Species Human (Homo sapiens) [TaxId:9606] [47777] (2 PDB entries)
  8. 1272227Domain d1b4fd_: 1b4f D: [17937]

Details for d1b4fd_

PDB Entry: 1b4f (more details), 1.95 Å

PDB Description: oligomeric structure of the human ephb2 receptor sam domain
PDB Compounds: (D:) ephb2

SCOPe Domain Sequences for d1b4fd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4fd_ a.60.1.2 (D:) EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]}
rpdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkkil
nsiqvmraqmnqiqs

SCOPe Domain Coordinates for d1b4fd_:

Click to download the PDB-style file with coordinates for d1b4fd_.
(The format of our PDB-style files is described here.)

Timeline for d1b4fd_: