Lineage for d1b4fd_ (1b4f D:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153720Fold a.60: SAM domain-like [47768] (11 superfamilies)
  4. 153721Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 153737Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (4 proteins)
  6. 153745Protein EphB2 receptor [47776] (2 species)
  7. 153748Species Human (Homo sapiens) [TaxId:9606] [47777] (2 PDB entries)
  8. 153752Domain d1b4fd_: 1b4f D: [17937]

Details for d1b4fd_

PDB Entry: 1b4f (more details), 1.95 Å

PDB Description: oligomeric structure of the human ephb2 receptor sam domain

SCOP Domain Sequences for d1b4fd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4fd_ a.60.1.2 (D:) EphB2 receptor {Human (Homo sapiens)}
rpdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkkil
nsiqvmraqmnqiqs

SCOP Domain Coordinates for d1b4fd_:

Click to download the PDB-style file with coordinates for d1b4fd_.
(The format of our PDB-style files is described here.)

Timeline for d1b4fd_: