Lineage for d3khbb_ (3khb B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2424882Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2425188Family b.82.2.10: AlkB-like [141628] (3 proteins)
    automatically mapped to Pfam PF13532
  6. 2425205Protein automated matches [191077] (2 species)
    not a true protein
  7. 2425206Species Escherichia coli K-12 [TaxId:83333] [189001] (20 PDB entries)
  8. 2425229Domain d3khbb_: 3khb B: [179369]
    automated match to d2fd8a1
    complexed with akg, co

Details for d3khbb_

PDB Entry: 3khb (more details), 2.9 Å

PDB Description: Crystal structure of Escherichia coli AlkB with Co(II) and 2-OG
PDB Compounds: (B:) Alpha-ketoglutarate-dependent dioxygenase AlkB

SCOPe Domain Sequences for d3khbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3khbb_ b.82.2.10 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
epwqeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlg
wtthrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgakl
slhqdkdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhg
iqplkagfhpltidcrynltfrqagk

SCOPe Domain Coordinates for d3khbb_:

Click to download the PDB-style file with coordinates for d3khbb_.
(The format of our PDB-style files is described here.)

Timeline for d3khbb_: