SCOPe 2.01: Domain d3kgxb_: 3kgx B:

Lineage for d3kgxb_ (3kgx B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)

6. Protein automated matches [190399] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189108] (2 PDB entries)

8. Domain d3kgxb_: 3kgx B: [179367]
   automated match to d1h0ca_
   complexed with cl, edo, mg

Details for d3kgxb_

PDB Entry: 3kgx, 1.8 Å

PDB Description: crystal structure of putative aminotransferase (aah25799.1) from mus musculus at 1.80 a resolution

PDB Compounds: (B:) Alanine-glyoxylate aminotransferase

SCOPe Domain Sequences for d3kgxb_:

Sequence; same for both SEQRES and ATOM records:

>d3kgxb_ c.67.1.3 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mgsyqllvpppealskplsvptrlllgpgpsnlaprvlaagslrmighmqkemlqimeei
kqgiqyvfqtrnpltlvvsgsghcametalfnllepgdsfltgtngiwgmraaeiadrig
arvhqmikkpgehytlqeveeglaqhkpvllflvhgesstgvvqpldgfgelchryqcll
lvdsvaslggvpiymdqqgidimysssqkvlnappgislisfndkakykvysrktkpvsf
ytditylaklwgcegetrvihhttpvtslyclreslaliaeqglencwrrhreatahlhk
hlqemglkffvkdpeirlptittvtvpagynwrdivsyvldhfsieisgglgpteervlr
igllgynattenvdrvaealrealqhcpkn

Timeline for d3kgxb_:

• d3kgxb_ is new in SCOPe 2.01-stable
  
• d3kgxb_ appears in SCOPe 2.02
  
• d3kgxb_ appears in the current release, SCOPe 2.08