Lineage for d3kgxb_ (3kgx B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131439Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)
  6. 2131631Protein automated matches [190399] (9 species)
    not a true protein
  7. 2131661Species Mouse (Mus musculus) [TaxId:10090] [189108] (2 PDB entries)
  8. 2131665Domain d3kgxb_: 3kgx B: [179367]
    automated match to d1h0ca_
    complexed with cl, edo, mg

Details for d3kgxb_

PDB Entry: 3kgx (more details), 1.8 Å

PDB Description: crystal structure of putative aminotransferase (aah25799.1) from mus musculus at 1.80 a resolution
PDB Compounds: (B:) Alanine-glyoxylate aminotransferase

SCOPe Domain Sequences for d3kgxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kgxb_ c.67.1.3 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mgsyqllvpppealskplsvptrlllgpgpsnlaprvlaagslrmighmqkemlqimeei
kqgiqyvfqtrnpltlvvsgsghcametalfnllepgdsfltgtngiwgmraaeiadrig
arvhqmikkpgehytlqeveeglaqhkpvllflvhgesstgvvqpldgfgelchryqcll
lvdsvaslggvpiymdqqgidimysssqkvlnappgislisfndkakykvysrktkpvsf
ytditylaklwgcegetrvihhttpvtslyclreslaliaeqglencwrrhreatahlhk
hlqemglkffvkdpeirlptittvtvpagynwrdivsyvldhfsieisgglgpteervlr
igllgynattenvdrvaealrealqhcpkn

SCOPe Domain Coordinates for d3kgxb_:

Click to download the PDB-style file with coordinates for d3kgxb_.
(The format of our PDB-style files is described here.)

Timeline for d3kgxb_: