Lineage for d3kgfb_ (3kgf B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086424Family c.1.10.8: Class-II DAHP synthetase [141840] (2 protein domains)
    Pfam PF01474
  6. 2086425Protein Probable DAHP synthetase AroG, phenylalanine-repressible [141841] (1 species)
  7. 2086426Species Mycobacterium tuberculosis [TaxId:1773] [141842] (11 PDB entries)
    Uniprot O53512 1-462
  8. 2086428Domain d3kgfb_: 3kgf B: [179355]
    automated match to d2b7oa1
    complexed with cl, gol, mn, phe, po4, so4, trp

Details for d3kgfb_

PDB Entry: 3kgf (more details), 2 Å

PDB Description: The structure of 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase from Mycobacterium tuberculosis complexed with phenylalanine and tryptophan
PDB Compounds: (B:) Probable 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase AroG

SCOPe Domain Sequences for d3kgfb_:

Sequence, based on SEQRES records: (download)

>d3kgfb_ c.1.10.8 (B:) Probable DAHP synthetase AroG, phenylalanine-repressible {Mycobacterium tuberculosis [TaxId: 1773]}
mnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtv
pseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmp
vvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaam
nlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnlqt
aeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqvia
npvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghq
viwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvtec
lggaqdisetdlagryetacdprlntqqslelaflvaemlrd

Sequence, based on observed residues (ATOM records): (download)

>d3kgfb_ c.1.10.8 (B:) Probable DAHP synthetase AroG, phenylalanine-repressible {Mycobacterium tuberculosis [TaxId: 1773]}
mnwtvdipilpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtvpseiv
rlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmpvvkva
riagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaamnlvra
ltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnlqtaeiya
shealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqvianpvgv
klgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghqviwqc
dpmhgnthesfktrhfdrivdevqgffevhralgthpggihveitgenvteclggaqdis
etdlagryetacdprlntqqslelaflvaemlrd

SCOPe Domain Coordinates for d3kgfb_:

Click to download the PDB-style file with coordinates for d3kgfb_.
(The format of our PDB-style files is described here.)

Timeline for d3kgfb_: