Lineage for d1b4fb_ (1b4f B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 98579Fold a.60: SAM domain-like [47768] (11 superfamilies)
  4. 98580Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 98585Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (3 proteins)
  6. 98593Protein EphB2 receptor [47776] (2 species)
  7. 98596Species Human (Homo sapiens) [TaxId:9606] [47777] (2 PDB entries)
  8. 98598Domain d1b4fb_: 1b4f B: [17935]

Details for d1b4fb_

PDB Entry: 1b4f (more details), 1.95 Å

PDB Description: oligomeric structure of the human ephb2 receptor sam domain

SCOP Domain Sequences for d1b4fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4fb_ a.60.1.2 (B:) EphB2 receptor {Human (Homo sapiens)}
trpdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkki
lnsiqvmraqmnqiqsv

SCOP Domain Coordinates for d1b4fb_:

Click to download the PDB-style file with coordinates for d1b4fb_.
(The format of our PDB-style files is described here.)

Timeline for d1b4fb_: