SCOPe 2.04: Domain d3kfrb_: 3kfr B:

Lineage for d3kfrb_ (3kfr B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (432 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d3kfrb_: 3kfr B: [179345]
   automated match to d1a8ga_
   complexed with 1f1, 3tl, bme

Details for d3kfrb_

PDB Entry: 3kfr, 1.3 Å

PDB Description: hiv protease (pr) dimer with inhibitor tl-3 bound and fragment 1f1 in the outside/top of flap

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3kfrb_:

Sequence; same for both SEQRES and ATOM records:

>d3kfrb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d3kfrb_:

• d3kfrb_ first appeared in SCOPe 2.01
  
• d3kfrb_ appears in SCOPe 2.03
  
• d3kfrb_ appears in SCOPe 2.05
  
• d3kfrb_ appears in the current release, SCOPe 2.08