| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) ![]() has a additional strand at the N-terminus |
| Family d.17.1.2: Cystatins [54407] (7 proteins) automatically mapped to Pfam PF00031 |
| Protein Cystatin A (stefin A) [54412] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54413] (12 PDB entries) |
| Domain d3kfqd_: 3kfq D: [179343] Other proteins in same PDB: d3kfqa_, d3kfqb_ automated match to d1dvca_ |
PDB Entry: 3kfq (more details), 1.99 Å
SCOPe Domain Sequences for d3kfqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kfqd_ d.17.1.2 (D:) Cystatin A (stefin A) {Human (Homo sapiens) [TaxId: 9606]}
mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag
dnkymhlkvfkslpgqnedlvltgyqvdknkddeltgf
Timeline for d3kfqd_: