Lineage for d3kfqd_ (3kfq D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935698Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2935752Family d.17.1.2: Cystatins [54407] (7 proteins)
    automatically mapped to Pfam PF00031
  6. 2935758Protein Cystatin A (stefin A) [54412] (1 species)
  7. 2935759Species Human (Homo sapiens) [TaxId:9606] [54413] (12 PDB entries)
  8. 2935764Domain d3kfqd_: 3kfq D: [179343]
    Other proteins in same PDB: d3kfqa_, d3kfqb_
    automated match to d1dvca_

Details for d3kfqd_

PDB Entry: 3kfq (more details), 1.99 Å

PDB Description: unreduced cathepsin v in complex with stefin a
PDB Compounds: (D:) Cystatin-A

SCOPe Domain Sequences for d3kfqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kfqd_ d.17.1.2 (D:) Cystatin A (stefin A) {Human (Homo sapiens) [TaxId: 9606]}
mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag
dnkymhlkvfkslpgqnedlvltgyqvdknkddeltgf

SCOPe Domain Coordinates for d3kfqd_:

Click to download the PDB-style file with coordinates for d3kfqd_.
(The format of our PDB-style files is described here.)

Timeline for d3kfqd_: