Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein automated matches [190163] (13 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188249] (10 PDB entries) |
Domain d3kfia_: 3kfi A: [179334] automated match to d1df3a_ complexed with 25r, cl |
PDB Entry: 3kfi (more details), 1.42 Å
SCOPe Domain Sequences for d3kfia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kfia_ b.60.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} lnvekingewfsillasdkrekieehgsmrvfvehihvlenslafkfhtvidgecseifl vadktekageysvmydgfntftilktdydnyimfhlinekdgktfqlmelygrkadlnsd ikekfvklceehgiikeniidltktnrclkar
Timeline for d3kfia_: