Lineage for d3kfia_ (3kfi A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804764Protein automated matches [190163] (13 species)
    not a true protein
  7. 2804824Species Mouse (Mus musculus) [TaxId:10090] [188249] (10 PDB entries)
  8. 2804827Domain d3kfia_: 3kfi A: [179334]
    automated match to d1df3a_
    complexed with 25r, cl

Details for d3kfia_

PDB Entry: 3kfi (more details), 1.42 Å

PDB Description: major mouse urinary protein iv complexed with 2,5-dimethylpyrazine
PDB Compounds: (A:) Major urinary protein 4

SCOPe Domain Sequences for d3kfia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kfia_ b.60.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lnvekingewfsillasdkrekieehgsmrvfvehihvlenslafkfhtvidgecseifl
vadktekageysvmydgfntftilktdydnyimfhlinekdgktfqlmelygrkadlnsd
ikekfvklceehgiikeniidltktnrclkar

SCOPe Domain Coordinates for d3kfia_:

Click to download the PDB-style file with coordinates for d3kfia_.
(The format of our PDB-style files is described here.)

Timeline for d3kfia_: