Lineage for d1b0xa_ (1b0x A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770823Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 770824Superfamily a.60.1: SAM/Pointed domain [47769] (3 families) (S)
  5. 770859Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (15 proteins)
  6. 770873Protein EphA4 receptor tyrosine kinases [47774] (1 species)
  7. 770874Species Mouse (Mus musculus) [TaxId:10090] [47775] (1 PDB entry)
  8. 770875Domain d1b0xa_: 1b0x A: [17933]

Details for d1b0xa_

PDB Entry: 1b0x (more details), 2 Å

PDB Description: the crystal structure of an eph receptor sam domain reveals a mechanism for modular dimerization.
PDB Compounds: (A:) protein (epha4 receptor tyrosine kinase)

SCOP Domain Sequences for d1b0xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0xa_ a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mouse (Mus musculus) [TaxId: 10090]}
fsavvsvgdwlqaikmdrykdnftaagyttleavvhmsqddlarigitaithqnkilssv
qamrtqmqqmhg

SCOP Domain Coordinates for d1b0xa_:

Click to download the PDB-style file with coordinates for d1b0xa_.
(The format of our PDB-style files is described here.)

Timeline for d1b0xa_: