Lineage for d1b0xa_ (1b0x A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.60: SAM domain-like [47768] (10 superfamilies) 
Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) 
Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (3 proteins) Protein EphA4 receptor tyrosine kinases [47774] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [47775] (1 PDB entry) 
Domain d1b0xa_: 1b0x A: [17933]
Details for d1b0xa_
PDB Entry: 1b0x (more details), 2 Å
PDB Description: the crystal structure of an eph receptor sam domain reveals a mechanism for modular dimerization.
SCOP Domain Sequences for d1b0xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b0xa_ a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mouse (Mus musculus)}
fsavvsvgdwlqaikmdrykdnftaagyttleavvhmsqddlarigitaithqnkilssv
qamrtqmqqmhg
SCOP Domain Coordinates for d1b0xa_:
Click to download the PDB-style file with coordinates for d1b0xa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b0xa_:
- d1b0xa_ appears in SCOP 1.57
- d1b0xa_ appears in the current release, SCOPe 2.08
View in 3D