Lineage for d3kfcb_ (3kfc B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728875Protein Oxysterols receptor LXR-beta [89149] (1 species)
  7. 2728876Species Human (Homo sapiens) [TaxId:9606] [89150] (21 PDB entries)
    Uniprot P55055 219-461
  8. 2728894Domain d3kfcb_: 3kfc B: [179328]
    automated match to d1p8da_
    protein/DNA complex; complexed with 61x

Details for d3kfcb_

PDB Entry: 3kfc (more details), 2.4 Å

PDB Description: Complex Structure of LXR with an agonist
PDB Compounds: (B:) oxysterols receptor lxr-beta

SCOPe Domain Sequences for d3kfcb_:

Sequence, based on SEQRES records: (download)

>d3kfcb_ a.123.1.1 (B:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]}
qltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdarqqrfahftelaiis
vqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskd
dfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqp
yveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd

Sequence, based on observed residues (ATOM records): (download)

>d3kfcb_ a.123.1.1 (B:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]}
qltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwpdarqqrfahftelaiisvqeivdfa
kqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhraglq
vefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveallsy
trikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd

SCOPe Domain Coordinates for d3kfcb_:

Click to download the PDB-style file with coordinates for d3kfcb_.
(The format of our PDB-style files is described here.)

Timeline for d3kfcb_: