SCOPe 2.02: Domain d3kfab_: 3kfa B:

Lineage for d3kfab_ (3kfa B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (10 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187169] (27 PDB entries)

8. Domain d3kfab_: 3kfa B: [179326]
   automated match to d1opjb_
   complexed with b91

Details for d3kfab_

PDB Entry: 3kfa, 1.22 Å

PDB Description: structural analysis of dfg-in and dfg-out dual src-abl inhibitors sharing a common vinyl purine template

PDB Compounds: (B:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d3kfab_:

Sequence; same for both SEQRES and ATOM records:

>d3kfab_ d.144.1.7 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
avmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqi
ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelg

Timeline for d3kfab_:

• d3kfab_ first appeared in SCOPe 2.01
  
• d3kfab_ appears in SCOPe 2.03
  
• d3kfab_ appears in the current release, SCOPe 2.08, called d3kfab1