Lineage for d3kf9a_ (3kf9 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711203Protein automated matches [190064] (21 species)
    not a true protein
  7. 2711360Species Scherffelia dubia [TaxId:3190] [189616] (1 PDB entry)
  8. 2711361Domain d3kf9a_: 3kf9 A: [179324]
    automated match to d2ggma1
    complexed with ca

Details for d3kf9a_

PDB Entry: 3kf9 (more details), 2.6 Å

PDB Description: Crystal structure of the SdCen/skMLCK complex
PDB Compounds: (A:) Caltractin

SCOPe Domain Sequences for d3kf9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kf9a_ a.39.1.5 (A:) automated matches {Scherffelia dubia [TaxId: 3190]}
glteeqkqeireafdlfdtdgsgtidakelkvamralgfepkkeeikkmiadidkdgsgt
idfeeflqmmtakmgerdsreeimkafrlfdddetgkisfknlkrvakelgenmtdeelq
emideadrdgdgevneeeffrimkktslf

SCOPe Domain Coordinates for d3kf9a_:

Click to download the PDB-style file with coordinates for d3kf9a_.
(The format of our PDB-style files is described here.)

Timeline for d3kf9a_: